NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12664J13189_1000209

Scaffold JGI12664J13189_1000209


Overview

Basic Information
Taxon OID3300001082 Open in IMG/M
Scaffold IDJGI12664J13189_1000209 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8233
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F003669Metagenome / Metatranscriptome474Y
F013120Metagenome / Metatranscriptome274Y

Sequences

Protein IDFamilyRBSSequence
JGI12664J13189_100020911F003669AGGAGGMCPFCLATMGFVVAGAVSTGVLAALAVKVSRKRNGAEEIISNLNNKEK*
JGI12664J13189_10002095F013120GGAGGMEYFRFDHPPDRLILCDRSNCETIADYLEINEHGREDFVCAAHTSSERHASVLPKGVPNGERHGSRTTP*
JGI12664J13189_10002096F000042AGAAGGMKNTKFVVKLSRGATRAPEFVLRIDRTPIQMTTNRKLALVMGKFAAEDTINSLQNSRRTPELIAVQVECGQLAV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.