NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11949J13268_1000278

Scaffold JGI11949J13268_1000278


Overview

Basic Information
Taxon OID3300001123 Open in IMG/M
Scaffold IDJGI11949J13268_1000278 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP2969
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7028
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth of Funchal, North Atlantic Ocean
CoordinatesLat. (o)32.08Long. (o)-17.26Alt. (m)Depth (m)4002.6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089571Metagenome109N

Sequences

Protein IDFamilyRBSSequence
JGI11949J13268_10002784F089571AGGAGMFIIYLGKENERKMLKNIIVIVFSVLFLVVPASSQHVQQKYAITDKDEKVILNDNGTWEYAEEDKQNYYYKKVPPKTYNYEFKSQTWEERIEQXAHEYWRIRAHAELEQLGIPVTRYDPTTSDVPLYLKLEGGRIRTDFDSFTPLARGEVIDISGLWDPDKGDNPTLKIQGKLFLQITMKLDDQKKLFSQYNQRNYIPIPDDFQRILEFRDSLDVISLGMHDYNRDNTHIWPGIPHSFLYAPPGSYYDPNNPPIIHGDGFPYIQRGHLTLSRREIPMTNSVYDNLLKRIDNLEGHGXIKIRYDMGKGIIETVTFEEVWLKINPYNGDPTHILKKVSLNKLE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.