NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J13889_100022

Scaffold B570J13889_100022


Overview

Basic Information
Taxon OID3300001255 Open in IMG/M
Scaffold IDB570J13889_100022 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3421
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011666Metagenome288Y
F038240Metagenome / Metatranscriptome166Y
F056612Metagenome / Metatranscriptome137N

Sequences

Protein IDFamilyRBSSequence
B570J13889_1000221F011666N/ALILRVWQYLLLRPLMEWHPIERTQESQFSEVATAKMLEEWLKKGDIKGIYNAALLLNTMLHQQRTITKWLAGEAARNLGRPDLEGEILQKSIIQSE*
B570J13889_1000226F056612GAGMYKTESTFESAFIGQISLFANKNKKHEKSPDKTGTIELELSEAMKLAEYLTAHPGEQNYAGKTVVKLAINAWDKRSEGGTEYVGGTVWAKKPEAGVNDLPVF*
B570J13889_1000227F038240N/AMATPAGNKMRVQVLLDPEALQMMEREVALRYNSASRVTVSSLANEIIKSHYAILESQDVQD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.