NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ML8_10042423

Scaffold ML8_10042423


Overview

Basic Information
Taxon OID3300001335 Open in IMG/M
Scaffold IDML8_10042423 Open in IMG/M
Source Dataset NameWetlands benthic microbial communities from British Columbia, Canada - ML8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1783
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic → Wetlands Benthic Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)49.283333Long. (o)-119.583333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015275Metagenome / Metatranscriptome256Y

Sequences

Protein IDFamilyRBSSequence
ML8_100424232F015275AGGAGGVKAEFGFIDPGAIMGVVVSLIILAVGVFAFFVTISEIPTDDDTTISAAVNNVGDTGNSVFNIIGIVLIIGAIMSIVGLVYNYVR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.