NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ML8_10098887

Scaffold ML8_10098887


Overview

Basic Information
Taxon OID3300001335 Open in IMG/M
Scaffold IDML8_10098887 Open in IMG/M
Source Dataset NameWetlands benthic microbial communities from British Columbia, Canada - ML8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)939
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic → Wetlands Benthic Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)49.283333Long. (o)-119.583333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034747Metagenome174Y

Sequences

Protein IDFamilyRBSSequence
ML8_100988872F034747AGGLGYRNIAQSFKLEIIKKGNKMSRNAYRVKRIITAKNPSFNLSYDEELLSILEEYTDFYNTLNSYGNGIIEITSREFEEVKDKIEELIDGLKSTKTNQPENREKANSCKKVLSEMDRVIKKEGYISYEIY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.