Scaffold ML8_10111044

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ML8_10111044

Scaffold ML8_10111044

Overview

Basic Information
Taxon OID	3300001335 Open in IMG/M
Scaffold ID	ML8_10111044 Open in IMG/M
Source Dataset Name	Wetlands benthic microbial communities from British Columbia, Canada - ML8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1092
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → unclassified Acinetobacter → Acinetobacter sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic → Wetlands Benthic Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location Name	British Columbia, Canada
Coordinates	Lat. (^o)	49.283333	Long. (^o)	-119.583333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099974	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
ML8_101110443	F099974	N/A	VGAETQKLATVSFVTDTDVSYYEIGEVEGSFQKDELKDYVKRFGHEKLCSQLAFLQFQVWQALREVNSERENDSAKSCSQNGL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.