NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ML7_10185089

Scaffold ML7_10185089


Overview

Basic Information
Taxon OID3300001336 Open in IMG/M
Scaffold IDML7_10185089 Open in IMG/M
Source Dataset NameML7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPennsylvania State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)670
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake → Benthic Lake Microbial Communities From British Columbia, Canada, For Chemocline Samples

Source Dataset Sampling Location
Location NameWetlands, British Columbia
CoordinatesLat. (o)49.283333Long. (o)-119.583333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034945Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
ML7_101850891F034945AGGMGDRANVGIRGTDGNTIFLYLHWGGQDRHEIVANAIAHAMARDGDESYFTRIFVSRVIEHDWDKETGVGMLVNKLPSTGDGYDVPVYDYLTKKVSVHEEKWDKAGGYIDLDPVMVYTRDEYLAKYGVRSVGAYA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.