NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20153J14318_10030180

Scaffold JGI20153J14318_10030180


Overview

Basic Information
Taxon OID3300001351 Open in IMG/M
Scaffold IDJGI20153J14318_10030180 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_03
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2345
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012347Metagenome / Metatranscriptome281N

Sequences

Protein IDFamilyRBSSequence
JGI20153J14318_100301801F012347AGGAMNRIKHGNTTKWSAAKAGQIIEFASSKPRHVKFELTANSNVEIWVATDNKMSDAVLMGTSNGKTEIQYTAPATTFVQIKAEKSADVFVNIPDVDQSVQNSDEPSFTSIEPRVNNSTEFDRMVQFMKHNETQRNAQLEAERAALRAEVAKIKAEAETVVEAPQEAETEDAGETPE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.