NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12269J14319_10011969

Scaffold JGI12269J14319_10011969


Overview

Basic Information
Taxon OID3300001356 Open in IMG/M
Scaffold IDJGI12269J14319_10011969 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6864
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002916Metagenome / Metatranscriptome521Y
F045236Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
JGI12269J14319_100119692F002916GAGGMQYLPGWTVQCLTPECPARGHWLRVEGLPQEICSNCGAPLHNVPPPLAPRFRMRPRPLASYRPARRPR*
JGI12269J14319_100119695F045236GGGGGMAAKTPKILLIAASPMGMSFLAARLKKWACEIHFASSCKEANAFVGNQRFDLVLSEFRLWDGSPYPLAASLIGSSTTLVYSYPVETGCWWLPAVKNGQSCWGSLAMRPSEFIGFLDEILNEIRSRQTASSDEVSERLFKVMAK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.