Basic Information | |
---|---|
Taxon OID | 3300001372 Open in IMG/M |
Scaffold ID | YBBDRAFT_1160604 Open in IMG/M |
Source Dataset Name | YB-Back-sed |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of South Carolina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1182 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Youngs Bay mouth | |||||||
Coordinates | Lat. (o) | 46.15968 | Long. (o) | -123.80651 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103749 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
YBBDRAFT_11606042 | F103749 | GGAG | MADYLVIDADGHCYEPDNELAKWMPKEYVHVAPNRVTDSSGYSHLMLEGR |
⦗Top⦘ |