Scaffold YBBDRAFT_1286670

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YBBDRAFT_1286670

Scaffold YBBDRAFT_1286670

Overview

Basic Information
Taxon OID	3300001372 Open in IMG/M
Scaffold ID	YBBDRAFT_1286670 Open in IMG/M
Source Dataset Name	YB-Back-sed
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of South Carolina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	711
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Youngs Bay mouth
Coordinates	Lat. (^o)	46.15968	Long. (^o)	-123.80651	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046727	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
YBBDRAFT_12866701	F046727	GGAGG	MTLTKLTCMYGHLEAIDGKFARDITGYLSIDSGIYAKHGLEVSWNHVQGTEERYRRLETGEAQISFVVGRASLQHFLDTQATRVLGCAMNTCPYLLVVDPAIREIKDLKNQVVVCREG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.