Basic Information | |
---|---|
Taxon OID | 3300001386 Open in IMG/M |
Scaffold ID | MG2b_10023 Open in IMG/M |
Source Dataset Name | Cayman MG2b |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 23783 |
Total Scaffold Genes | 15 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mid Cayman Rise | |||||||
Coordinates | Lat. (o) | 18.43001 | Long. (o) | -81.46999 | Alt. (m) | Depth (m) | 4953 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005684 | Metagenome / Metatranscriptome | 393 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MG2b_1002311 | F005684 | AGGAGG | VYDTEESPLSAMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS* |
⦗Top⦘ |