NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MG2b_10023

Scaffold MG2b_10023


Overview

Basic Information
Taxon OID3300001386 Open in IMG/M
Scaffold IDMG2b_10023 Open in IMG/M
Source Dataset NameCayman MG2b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23783
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea

Source Dataset Sampling Location
Location NameMid Cayman Rise
CoordinatesLat. (o)18.43001Long. (o)-81.46999Alt. (m)Depth (m)4953
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005684Metagenome / Metatranscriptome393Y

Sequences

Protein IDFamilyRBSSequence
MG2b_1002311F005684AGGAGGVYDTEESPLSAMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.