Basic Information | |
---|---|
Taxon OID | 3300001389 Open in IMG/M |
Scaffold ID | BDMCk91_101539 Open in IMG/M |
Source Dataset Name | Benzene-degrading bioreactor methanogenic microbial communities from Toronto, Canada - k91 assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3105 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor Methanogenic → Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Toronto, Canada | |||||||
Coordinates | Lat. (o) | 43.66266 | Long. (o) | -79.3917 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F050029 | Metagenome / Metatranscriptome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BDMCk91_1015396 | F050029 | AGGAGG | MATILIHWKDKNLPAMEIKDAAYKGADSSIIKITSNGNEYWFNWNECWFLETTSTNDIPI |
⦗Top⦘ |