Scaffold BDMCk91_101539

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BDMCk91_101539

Scaffold BDMCk91_101539

Overview

Basic Information
Taxon OID	3300001389 Open in IMG/M
Scaffold ID	BDMCk91_101539 Open in IMG/M
Source Dataset Name	Benzene-degrading bioreactor methanogenic microbial communities from Toronto, Canada - k91 assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3105
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor Methanogenic → Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada

Source Dataset Sampling Location
Location Name	Toronto, Canada
Coordinates	Lat. (^o)	43.66266	Long. (^o)	-79.3917	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050029	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
BDMCk91_1015396	F050029	AGGAGG	MATILIHWKDKNLPAMEIKDAAYKGADSSIIKITSNGNEYWFNWNECWFLETTSTNDIPI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.