NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Lau_10032950

Scaffold Lau_10032950


Overview

Basic Information
Taxon OID3300001392 Open in IMG/M
Scaffold IDLau_10032950 Open in IMG/M
Source Dataset NameELSC Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2266
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From The Eastern Lau Spreading Center

Source Dataset Sampling Location
Location NameKilo Moana - ELSC (Lau Basin)
CoordinatesLat. (o)-20.0Long. (o)176.0Alt. (m)Depth (m)2600
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001607Metagenome / Metatranscriptome664Y
F001614Metagenome / Metatranscriptome663Y

Sequences

Protein IDFamilyRBSSequence
Lau_100329502F001614GAGMLNFVGTYGGLICGFGGFLTAIAALLYARARVAEFEKSVRDLDWQQVSELSLDVAKLKKAAQKWQNNTNAQEKVSQKDLLERAYMERLMQQNGNVQQIRKVEM*
Lau_100329504F001607AGGMPVLANNVSLTAGSSSSNLFDNTNYQFVNEGTALRIYGAVVGANDGVQGSNLNYRFTINNTEFADDAVVPALVTGQPFTGVDGGPYLLNNVIATGQARNRPLLVFRNQTSGTLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.