NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Lau_10053269

Scaffold Lau_10053269


Overview

Basic Information
Taxon OID3300001392 Open in IMG/M
Scaffold IDLau_10053269 Open in IMG/M
Source Dataset NameELSC Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4415
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From The Eastern Lau Spreading Center

Source Dataset Sampling Location
Location NameKilo Moana - ELSC (Lau Basin)
CoordinatesLat. (o)-20.0Long. (o)176.0Alt. (m)Depth (m)2600
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007837Metagenome / Metatranscriptome344Y
F013596Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
Lau_100532692F013596AGGMEAFTPFLTVLSVVLPVSVCSVLIARIYRKNAALDPKITNKLRKQQEDYIGEVERKNRSLQNKLNSMQKGPEISEMGDLEGVLPELLGQVEGILPKWATKFLKSNPDIVNTVIEYAKSNPEKAKDLIGRFVKIKPKTQSASNETLQGL*
Lau_100532696F007837N/AVSGLSVLPKISARNLSLKLNTVIDLKTTAAALIVNYPAEYQALSQSLLIDNQDAANAVTVRINRSTNSITIAGGNFRAFNDAWIEQIDCTGASTNTQVTAQVSPLTQISPYGQGVTN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.