Scaffold Lau_10068399

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Lau_10068399

Scaffold Lau_10068399

Overview

Basic Information
Taxon OID	3300001392 Open in IMG/M
Scaffold ID	Lau_10068399 Open in IMG/M
Source Dataset Name	ELSC Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2214
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From The Eastern Lau Spreading Center

Source Dataset Sampling Location
Location Name	Kilo Moana - ELSC (Lau Basin)
Coordinates	Lat. (^o)	-20.0	Long. (^o)	176.0	Alt. (m)		Depth (m)	2600
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014191	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Lau_100683996	F014191	N/A	MKDLSFITADLLNDISWIDGIIYILLGLVVYATIKYINKKVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.