Scaffold JGI20173J14856_1000704

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20173J14856_1000704

Scaffold JGI20173J14856_1000704

Overview

Basic Information
Taxon OID	3300001412 Open in IMG/M
Scaffold ID	JGI20173J14856_1000704 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8512
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	Barrow Environmental Observatory site, Barrow, Alaska
Coordinates	Lat. (^o)	71.2999	Long. (^o)	-156.61	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050778	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20173J14856_10007042	F050778	GAG	MTCEECLSELATGSLREMPSDSAVMLHCATCPDCSQLTTLLREREYNAANVLNNLPPMSNPITVAETSVRTAQRRRVGRVVVMLSGAALVITIWIAAATTIIPALNRADANTSSTLRTETIPLSCLSPQQAADIINPYVRSRGSTYYVPTSGISAITVRGTGVELAKSRNLIRDFESDPAAACRSTQAAILKKLSQELSDEAAPAIAGKTPTAPKKQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.