NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold yes_13407910

Scaffold yes_13407910


Overview

Basic Information
Taxon OID3300001425 Open in IMG/M
Scaffold IDyes_13407910 Open in IMG/M
Source Dataset NameGoat rumen bacterial communities from Langston, Oklahoma, USA - velvet
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCornell University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)645
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa

Source Dataset Sampling Location
Location NameLangston, Oklahoma, USA
CoordinatesLat. (o)35.453976Long. (o)-97.515884Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068248Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
yes_134079101F068248N/ALNADEIVANINKLFQGMLIRQFGVDQITDKVRSRIASGNIADIQGWKNFLNDEIYNSEYGQTSRALVSEAMQDAQTNYNDQTLPLLSLLFLANSDKENFLSAFKAVNLARRTKETGNQIMDVVNTGLQGGILAGIKSGLGAIRNVTGTVQQAVNPSMIRKDDLRNLASYYVNFLTLLPVNLLANHNEGLPMKRYFVPVLNNAFNRNVQNTFVDN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.