NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12363J15224_100216

Scaffold JGI12363J15224_100216


Overview

Basic Information
Taxon OID3300001464 Open in IMG/M
Scaffold IDJGI12363J15224_100216 Open in IMG/M
Source Dataset NameForest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12121
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (85.71%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameBrowns Valley, California, USA
CoordinatesLat. (o)39.23550963Long. (o)-121.2836963Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008036Metagenome340Y

Sequences

Protein IDFamilyRBSSequence
JGI12363J15224_10021613F008036AGGAGGMAEEGDGGGAGSVGVVAIVVIFVLIILVGVFMFRNRIFGGGGSQKIDVNIQTPSK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.