Scaffold TahiMoana_1073556

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TahiMoana_1073556

Scaffold TahiMoana_1073556

Overview

Basic Information
Taxon OID	3300001516 Open in IMG/M
Scaffold ID	TahiMoana_1073556 Open in IMG/M
Source Dataset Name	Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokers
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1116
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tahi Moana, Pacific Ocean, Of Black Smokers

Source Dataset Sampling Location
Location Name	Tahi Moana, ELSC, Pacific Ocean
Coordinates	Lat. (^o)	-20.064428	Long. (^o)	-176.171974	Alt. (m)		Depth (m)	2230
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094574	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
TahiMoana_10735563	F094574	N/A	MYERFKQIQLERGKNATLRLNELIDKEVKEADPQFKELTAIRSKDAPDIIVPNPFVLDQFHSIPKWIEYMQTLTKTEHGELYLHLIALKNITQDFEDHRLD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.