NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TahiMoana_1142394

Scaffold TahiMoana_1142394


Overview

Basic Information
Taxon OID3300001516 Open in IMG/M
Scaffold IDTahiMoana_1142394 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokers
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)598
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tahi Moana, Pacific Ocean, Of Black Smokers

Source Dataset Sampling Location
Location NameTahi Moana, ELSC, Pacific Ocean
CoordinatesLat. (o)-20.064428Long. (o)-176.171974Alt. (m)Depth (m)2230
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014191Metagenome / Metatranscriptome265Y

Sequences

Protein IDFamilyRBSSequence
TahiMoana_11423941F014191N/AVMDLTFITAELLNDISWFDGIVYIILGLGIYAIIKYINNIFR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.