NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MLSed_10012832

Scaffold MLSed_10012832


Overview

Basic Information
Taxon OID3300001533 Open in IMG/M
Scaffold IDMLSed_10012832 Open in IMG/M
Source Dataset NameBenthic freshwater microbial communities from British Columbia, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6145
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic → Benthic Freshwater Sediment Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)49.283333Long. (o)-119.583333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098192Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
MLSed_100128321F098192AGGAGGMKCPLRIDSEGNVFDCYKDKCAWWVVDTEIEGSKEKGACAVLEIAVNGMFVTIGDDEEEDYE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.