Basic Information | |
---|---|
Taxon OID | 3300001533 Open in IMG/M |
Scaffold ID | MLSed_10014085 Open in IMG/M |
Source Dataset Name | Benthic freshwater microbial communities from British Columbia, Canada |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5746 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic → Benthic Freshwater Sediment Microbial Communities From British Columbia, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 49.283333 | Long. (o) | -119.583333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046256 | Metagenome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
MLSed_100140854 | F046256 | N/A | MIKHDYLLTGTFPWDGIRIAGRRFDSPELLAMMRRQCLCADSVRHACADLDVLPFAEEVAVIEGHICRAEAAYC* |
⦗Top⦘ |