 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001535 Open in IMG/M |
| Scaffold ID | A3PFW1_10026445 Open in IMG/M |
| Source Dataset Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3390 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axel Heiberg Island, Nunavut, Canada | |||||||
| Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055302 | Metagenome / Metatranscriptome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| A3PFW1_100264457 | F055302 | N/A | LGPALDKLAALAPLLILDEFAWNHMDEPTIDWYESQHRVLVAAGREPKGPPDLGEWRARHSDLHPYETLRVEVDARYDERHFEWRPYFYRWLEGPATESLEAGLIAAGAIRPIGFCYAGVSKETVRSPADSR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |