Basic Information | |
---|---|
Taxon OID | 3300001554 Open in IMG/M |
Scaffold ID | ShallowMG2_10003 Open in IMG/M |
Source Dataset Name | Hydrothermal vent plume microbial communities from the Cayman RIse, Caribbean Sea - Cayman Shallow_MG2b |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 53475 |
Total Scaffold Genes | 48 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 26 (54.17%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Von Damm hydrothermal vent, Caribbean Sea | |||||||
Coordinates | Lat. (o) | 18.3763 | Long. (o) | -81.7891 | Alt. (m) | Depth (m) | 2000 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005684 | Metagenome / Metatranscriptome | 393 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ShallowMG2_100039 | F005684 | AGGAGG | VYDTEESPLSTMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS* |
⦗Top⦘ |