NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10001866

Scaffold Draft_10001866


Overview

Basic Information
Taxon OID3300001580 Open in IMG/M
Scaffold IDDraft_10001866 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)21926
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)38 (80.85%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSuncor Tailings Pond 6, Northern Alberta, Canada
CoordinatesLat. (o)57.05Long. (o)-111.55Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018683Metagenome / Metatranscriptome233Y
F025021Metagenome / Metatranscriptome203Y
F087103Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Draft_1000186621F025021AGGAGMAELNFKGPVFKVTMTEYERGYGQRPMGEKFFDTEEEAKAFCEKWSDFSDPECFYRADYRKIA*
Draft_1000186635F087103GAGMKLLYDDYNQIYVWIDDNDENVELSPHFDYLEDAEQWFQRIKQEVTK*
Draft_100018668F018683AGGAGMVNPTKPKNGRTLTPSANLFKETIMEIKRFKQSQKFRVIVGPACFYATAKEIRNGIGDFTQCNAATQKALETLEFTRSSNGAAESAATGLAGTWEGLTVQLNLA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.