NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EMG_10006394

Scaffold EMG_10006394


Overview

Basic Information
Taxon OID3300001598 Open in IMG/M
Scaffold IDEMG_10006394 Open in IMG/M
Source Dataset NameElephant fecal microbiome from Asian Elephant in Hamburg Zoo, Germany
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18582
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (57.89%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Asian Elephant Fecal → Asian Elephant Fecal Microbial Communities From Hamburg Zoo, Germany

Source Dataset Sampling Location
Location NameHagenbeck zoo/Hamburg, Germany
CoordinatesLat. (o)53.595256Long. (o)9.941572Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098178Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
EMG_1000639411F098178AGAAGMKKYYILKLDSYEGDGSCLSVSADGSDAMFVVLLVDGASADIVDLGYSSVEALVQAWSNVQFENLGEFS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.