Basic Information | |
---|---|
Taxon OID | 3300001605 Open in IMG/M |
Scaffold ID | Draft_10258518 Open in IMG/M |
Source Dataset Name | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | McGill University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 995 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fort McMurray in northeastern Alberta, Canada | |||||||
Coordinates | Lat. (o) | 57.01116 | Long. (o) | -111.6 | Alt. (m) | Depth (m) | 0 to .1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041590 | Metagenome | 159 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_102585181 | F041590 | N/A | MNTYLITLTRTKVADVPAPLPMHTRIDTRTRKPESRAFTIDIPTSALPDTSTVPAQFRPLVDSALLDACEQTLNTFVTSKATAGNMQIPVGLFDLEKLLTATAQRRMTAALLIGMWRNSSKYVLEVAPKLTSQTGSALLRYQANIEKHEKRLAALTGKNPELNMSAEDLDKLMVNLTEADSETPXGEYLAXRTEEVRSKLVEDSEAL* |
⦗Top⦘ |