Scaffold P5cmW16_1000022

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P5cmW16_1000022

Scaffold P5cmW16_1000022

Overview

Basic Information
Taxon OID	3300001664 Open in IMG/M
Scaffold ID	P5cmW16_1000022 Open in IMG/M
Source Dataset Name	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11613
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location
Location Name	Axel Heiberg Island, Nunavut, Canada
Coordinates	Lat. (^o)	79.26	Long. (^o)	-90.46	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040820	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
P5cmW16_100002214	F040820	N/A	AYLADSAPGDVYAVRLPDLKVAWKKHLGGAPFGLLLHGGRLFVSLFSGAAVVELDPTSGALTASHAVSQGPAVLGVSPDGRVMTAGTRGEVDYVDGTSTPAGHGFGVAVVNSQVWTADYERAELVRADDGHRVGLPLPVFPFWLAPGASGTLLIAAEGGTEDTDPGGVLSFDGGATFKTLAQPRDPDQVVQSGSQILVAAHGDQEVLVIDGGQTHHWAVGSAPVAIAPDPAMSLLVTAVNAHE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.