Scaffold P5cmW16_1051774

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P5cmW16_1051774

Scaffold P5cmW16_1051774

Overview

Basic Information
Taxon OID	3300001664 Open in IMG/M
Scaffold ID	P5cmW16_1051774 Open in IMG/M
Source Dataset Name	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	719
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location
Location Name	Axel Heiberg Island, Nunavut, Canada
Coordinates	Lat. (^o)	79.26	Long. (^o)	-90.46	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081190	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
P5cmW16_10517742	F081190	GAGG	MRVRLNLATKALQTQRRFLVGAGVLGFVALIFFLAIGWHVYS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.