Scaffold KiloMoana_10048446

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold KiloMoana_10048446

Scaffold KiloMoana_10048446

Overview

Basic Information
Taxon OID	3300001680 Open in IMG/M
Scaffold ID	KiloMoana_10048446 Open in IMG/M
Source Dataset Name	Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1807
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (37.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Kilo Moana, Pacific Ocean

Source Dataset Sampling Location
Location Name	Kilo Moana, Lau Basin, Pacific Ocean
Coordinates	Lat. (^o)	-20.054108	Long. (^o)	-176.133522	Alt. (m)		Depth (m)	2600
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014191	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
KiloMoana_100484465	F014191	N/A	MDLTFITAELLNDISWFDGIVYIILGLGIYAIIKYINNIFR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.