NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KiloMoana_10111259

Scaffold KiloMoana_10111259


Overview

Basic Information
Taxon OID3300001680 Open in IMG/M
Scaffold IDKiloMoana_10111259 Open in IMG/M
Source Dataset NameBlack smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1321
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Kilo Moana, Pacific Ocean

Source Dataset Sampling Location
Location NameKilo Moana, Lau Basin, Pacific Ocean
CoordinatesLat. (o)-20.054108Long. (o)-176.133522Alt. (m)Depth (m)2600
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003617Metagenome / Metatranscriptome477Y
F021317Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
KiloMoana_101112591F003617N/ASKPVHVGSGACSDTDTGILLNEGDNAIYNQTYTLDPDMTAIIYKISLNFCAVLTVSSYTSGTYNLGSLHIRITERSTNDRLLYENTFTSTAGNRTGAGTDMHWFTQDIVETIKVRKGNPIDIQLDLITTTGSGTRQEGYAPLAPYQKTAVLKSFTPSGISLHLHPDLSHADGVFKYSKDRVSLLGQTVLGTPIRS*
KiloMoana_101112593F021317N/ALINNAPRILNEINKQIKEQELSGVTPDQMKGLLQKKQMLELVTNNAEVINIIGKPIIKKLLGLVKSL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.