NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Abe_10017070

Scaffold Abe_10017070


Overview

Basic Information
Taxon OID3300001681 Open in IMG/M
Scaffold IDAbe_10017070 Open in IMG/M
Source Dataset NameBlack smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4077
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameAbe, ELSC, Pacific Ocean
CoordinatesLat. (o)-20.111307Long. (o)-176.989014Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007837Metagenome / Metatranscriptome344Y
F055296Metagenome139Y

Sequences

Protein IDFamilyRBSSequence
Abe_100170702F055296N/AMIEMDTKLRSFQVENMAKYDKFREIQQSRNKKIGQRLNELIEKEVKEADPQFKELTAIRSKDAPDIIIPNPFVLDQFHSLPKWEEYLMTLTKKEHGELYLHLIALKKVTYEFDDHRLD*
Abe_100170706F007837N/AVTQPLVSAKNLSLKLRTVVNLKTTAAQLVINYPALHQGLSNSVMVDNQDAANAVTVRFNLQINAVTIGGGNFRTFNDAWIEQINLTGPSTNTQVTSQVSPIQQISPYGQGVTN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.