NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GBIDBA_10019510

Scaffold GBIDBA_10019510


Overview

Basic Information
Taxon OID3300001683 Open in IMG/M
Scaffold IDGBIDBA_10019510 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3602
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameGuyams Basin, Gulf of California, Pacific Ocean
CoordinatesLat. (o)27.015833Long. (o)-111.425Alt. (m)Depth (m)1993
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015023Metagenome258Y
F061914Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
GBIDBA_100195105F015023GAGMVMENKINDGVTKFTEHLNDTMDKPDGYSYELNTRGSKYFKVEMLSHGSRSVYCFIEKSTGNILKSAGWRAPAKGTRGSVLIVDSYKHSDWSGGWLYKIFGNVYGVVG*
GBIDBA_100195106F061914AGGAGMNTLKSILTTIFFLGGIVFAQEEAEEPKSSWSGEFSTDITLGDTVSFTTPYTGLSYSGDGWKLTSHLSEGSVNVEEAYYSIDAKFTSVILGQQRVPFGLSNHWHRPSGNPFVSEPSSQAYASGLGASTEFAGVGIAGFYGNDKGYSVRASYGSLGHTAGVSINSDEARLLDASGTFSYDSFGSIASYFEYDLSEETSGNLWYRAVISPSFTKGITALVGYSSVGDETETMYGVGYHYGNSYIRSELSADGDVSVRVSYTF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.