NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GBIDBA_10040954

Scaffold GBIDBA_10040954


Overview

Basic Information
Taxon OID3300001683 Open in IMG/M
Scaffold IDGBIDBA_10040954 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3105
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameGuyams Basin, Gulf of California, Pacific Ocean
CoordinatesLat. (o)27.015833Long. (o)-111.425Alt. (m)Depth (m)1993
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010876Metagenome / Metatranscriptome298Y
F021856Metagenome / Metatranscriptome217Y
F023623Metagenome209Y

Sequences

Protein IDFamilyRBSSequence
GBIDBA_100409542F021856N/AMTEKKLIELFQESAERLTKKTKNNSGAIHTMGGYGEIEHGRVCPFRSVSFEDCPLCILDSLDKL*
GBIDBA_100409545F010876GGAGMEIDKGAVGFNSSPLYRFILQEGKFKDVEFYFKNVELDHKHIPGEFDIVFGYEIIGGNYRDNGYPPDKEYMNCAVTEKNKDQFYVEIGKILKNLLILNDPRVILHKGKIL*
GBIDBA_100409546F023623AGGAMKIDFDTGRVIYNDEVDDLKESLEDLKIKESVGVEKEAVFSKTRHQGLPYGRLKYMCYCFLLMMDGLIGIVSFGQTQSIMAHKYLLSEWIMGDYNGDR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.