NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold supr50_109569

Scaffold supr50_109569


Overview

Basic Information
Taxon OID3300001707 Open in IMG/M
Scaffold IDsupr50_109569 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Supr50
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1365
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED264(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location
Location NameBeebe Vents, Mid Cayman Rise
CoordinatesLat. (o)18.35Long. (o)-81.85Alt. (m)Depth (m)4000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055180Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
supr50_1095693F055180GGAMMKFKEYLQVNADDSIEQIMSGEWIQKSRSTWKATDDEDNKIEIHNDGHDPELNGESWTVHTNTFILQNSS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.