Scaffold JGI24656J20076_1000388

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24656J20076_1000388

Scaffold JGI24656J20076_1000388

Overview

Basic Information
Taxon OID	3300001740 Open in IMG/M
Scaffold ID	JGI24656J20076_1000388 Open in IMG/M
Source Dataset Name	Marine viral communities from the Deep Pacific Ocean - MSP-114
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6681
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (85.71%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	14.5287	Long. (^o)	-118.7737	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057688	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24656J20076_10003887	F057688	GAGG	MKNNLLKAHYPSNTIFKQHFIIVGYEFGKKLEGELHKTVDIVCDCLHPDNTVDPRIEKLITKSELQELIDNQFMKRDGDQYIANPLLIYCVDDDYFLDEKRHTAQITATKRYYGIER*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.