NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ACM18_1005753

Scaffold ACM18_1005753


Overview

Basic Information
Taxon OID3300001778 Open in IMG/M
Scaffold IDACM18_1005753 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)867
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAmazon River plume to Atlantic Ocean
CoordinatesLat. (o)7.2875Long. (o)-53.0005Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002907Metagenome / Metatranscriptome521Y
F032098Metagenome / Metatranscriptome181Y

Sequences

Protein IDFamilyRBSSequence
ACM18_10057532F032098AGGVENSDYPYHELDPTTPWYEWLMYCEICHQLDVPGQPKWQRYAAYRNYLREVGVL*
ACM18_10057534F002907N/AMTKQNPYWFFQKWSIEEPSPLETLAEKVEQLEERIKLIEQEMVGQSNALYECWNSLDARIDILAEHKTDV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.