NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20217J20340_10256

Scaffold JGI20217J20340_10256


Overview

Basic Information
Taxon OID3300001801 Open in IMG/M
Scaffold IDJGI20217J20340_10256 Open in IMG/M
Source Dataset NameWetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk Metatranscriptome (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)827
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location NameTwitchell Island, Sacramento and San Joaquin Delta, California, USA
CoordinatesLat. (o)38.1072Long. (o)-121.6485Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007695Metagenome / Metatranscriptome346Y
F045132Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
JGI20217J20340_102561F045132N/AMHSSNHYPLGNCDSPKPETDLDYLTRLGAVSNRTSSPSSFFAFTDSARTLPEELVNPASIAKYISTRLQRGLVNQPDPAFPRSPGRILETSVGELLLTDLRLSS
JGI20217J20340_102562F007695N/AMAALKKAPLNCEQDALRVKRRDPWLEVNAPPKAVAVLELSGQDAETSYRRVLVWFAGRWRNHQSKRAEKPHSKSSGGDALDGPATRPETPLAVENSVGKLAALEAPNASMGKRAWRTPIPHFGP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.