Scaffold JGI20216J20342_1025549

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20216J20342_1025549

Scaffold JGI20216J20342_1025549

Overview

Basic Information
Taxon OID	3300001806 Open in IMG/M
Scaffold ID	JGI20216J20342_1025549 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	522
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location Name	Twitchell Island, Sacramento and San Joaquin Delta, California, USA
Coordinates	Lat. (^o)	38.107	Long. (^o)	-121.6475	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105449	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
JGI20216J20342_10255492	F105449	AGGAGG	MTLKCVECGRIALKLNAEKKCEECAKKDESMKSYFTKLFFINEGCARLVPAT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.