Scaffold JGI20218J20341_1002149

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20218J20341_1002149

Scaffold JGI20218J20341_1002149

Overview

Basic Information
Taxon OID	3300001808 Open in IMG/M
Scaffold ID	JGI20218J20341_1002149 Open in IMG/M
Source Dataset Name	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk Metatranscriptome (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	510
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location
Location Name	Twitchell Island, Sacramento and San Joaquin Delta, California, USA
Coordinates	Lat. (^o)	38.1067	Long. (^o)	-121.6464	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051759	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20218J20341_10021491	F051759	GGA	MGFAQAGVVAGEGKAVTSDQPQAGEKKGCDAPGSIDPVAGENGCRGAERRSVQRSRLRCSVPGMPVVGKAANR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.