Scaffold ACM21_1009240

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACM21_1009240

Scaffold ACM21_1009240

Overview

Basic Information
Taxon OID	3300001827 Open in IMG/M
Scaffold ID	ACM21_1009240 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2588
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Amazon River plume to Atlantic Ocean
Coordinates	Lat. (^o)	10.6822	Long. (^o)	-54.4213	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048278	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM21_10092409	F048278	GAG	MKDIIDVIVELSRMQGQAIDRAQAGLINTAVETAHDKWQNEKQKDNG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.