NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM27_1013313

Scaffold RCM27_1013313


Overview

Basic Information
Taxon OID3300001836 Open in IMG/M
Scaffold IDRCM27_1013313 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1342
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAfu?, Para, Brazil
CoordinatesLat. (o)-0.083883Long. (o)-51.051417Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067750Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
RCM27_10133132F067750N/AMKLWESKTWLYDRYVVKKLGIVNMAKEAGCSHMTIQRALIKYGILKGNI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.