NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM40_1079008

Scaffold RCM40_1079008


Overview

Basic Information
Taxon OID3300001839 Open in IMG/M
Scaffold IDRCM40_1079008 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)644
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameÁbidos, Para, Brazil
CoordinatesLat. (o)-1.919017Long. (o)-55.525717Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000766Metagenome / Metatranscriptome899Y
F009056Metagenome / Metatranscriptome323Y

Sequences

Protein IDFamilyRBSSequence
RCM40_10790081F009056GAGMKPVIGKATPAAASVLLQATALYPKRKKTSDGLLPSK
RCM40_10790083F000766N/AGPTFKGYQVKATIATPRQRLLKIPVFCYDVETDRFNVVTGYEDRALARLRLLEDAEANGDVLNWQDLTSGESRQVTIEQLSFTRLTPPDKRFSGFGGIIDIILRTV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.