NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2221_1023083

Scaffold GOS2221_1023083


Overview

Basic Information
Taxon OID3300001938 Open in IMG/M
Scaffold IDGOS2221_1023083 Open in IMG/M
Source Dataset NameMarine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1554
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameBedford Basin, Nova Scotia, Canada
CoordinatesLat. (o)44.690277Long. (o)-63.637222Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020790Metagenome / Metatranscriptome222Y
F062272Metagenome / Metatranscriptome131Y
F065620Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
GOS2221_10230833F065620N/AMNSIEELNIIVKDFDHKMAKIELAINNGGNSLDKQEELLLEYQMYQARKFLAIKEINKLINNK*
GOS2221_10230836F020790N/AMNITKQMMDKKLLQIAKFEQKYGTDHGITSVNAMKKYCTDQKYRDRVHAFNKASVETIKHYTKYGY*
GOS2221_10230837F062272GGAMYNKELIANTANKIIEEVDEHINKTIHWQMDPSDFELNEFDDLYELELQIKQQLLFSLIKRITK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.