 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001945 Open in IMG/M |
| Scaffold ID | GOS2241_1041513 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Galapagos, Equador - GS026 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1381 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Galapagos, Equador | |||||||
| Coordinates | Lat. (o) | 1.2641667 | Long. (o) | -90.295 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081298 | Metagenome / Metatranscriptome | 114 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2241_10415132 | F081298 | AGGA | MLLNKKSLFIPLVLLICSCNTSYQPLQSNSIFIGNDVDVRFAELVHKRFFHEIKTEQRIDILDLKYYEKPFFSGIGARPTNLEIYYDLSYRLGNENKIQNINVKDNVYVNEFNPIAQNNAVSQISYELMNQLIDELIMKVRN* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |