Scaffold GOS2235_1049371

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2235_1049371

Scaffold GOS2235_1049371

Overview

Basic Information
Taxon OID	3300001954 Open in IMG/M
Scaffold ID	GOS2235_1049371 Open in IMG/M
Source Dataset Name	Marine microbial communities from Colon, Panama - GS019
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1884
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Colon, Panama
Coordinates	Lat. (^o)	10.716389	Long. (^o)	-80.25445	Alt. (m)		Depth (m)	1.7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035336	Metagenome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2235_10493712	F035336	N/A	MKTFKQLMEELPKPVTPKQLDVVKSDTRFIRTPDVIKKENQKFRSLYPFPSSFLPTAKKKTKKNIKTA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.