Scaffold GOS2247_1008154

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2247_1008154

Scaffold GOS2247_1008154

Overview

Basic Information
Taxon OID	3300001959 Open in IMG/M
Scaffold ID	GOS2247_1008154 Open in IMG/M
Source Dataset Name	Mangrove swamp microbial communities from Isabella Island, Equador - GS032
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1477
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Isabella Island, Equador
Coordinates	Lat. (^o)	-0.5938889	Long. (^o)	-91.06944	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062827	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2247_10081542	F062827	GAGG	MQLSITQFQADLIKNSLKLYNIEMLSSSKEWKEYDNLFDKLADLSDTSRADDFYKQSHPNRNGKDLDLL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.