Basic Information | |
---|---|
Taxon OID | 3300001962 Open in IMG/M |
Scaffold ID | GOS2239_1017076 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Cocos Island, Costa Rica - GS023 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1683 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cocos Island, Costa Rica | |||||||
Coordinates | Lat. (o) | 5.64 | Long. (o) | -86.56528 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080141 | Metagenome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2239_10170762 | F080141 | GGAG | MKTLAWVLVIINQSQVVTDGELLYPSLQKCEIYEKQVNRPLQKIQRYTFSAYCRPAVVDKEEE* |
⦗Top⦘ |