NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2239_1046336

Scaffold GOS2239_1046336


Overview

Basic Information
Taxon OID3300001962 Open in IMG/M
Scaffold IDGOS2239_1046336 Open in IMG/M
Source Dataset NameMarine microbial communities from Cocos Island, Costa Rica - GS023
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1271
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Libanvirus → unclassified Libanvirus → Libanvirus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameCocos Island, Costa Rica
CoordinatesLat. (o)5.64Long. (o)-86.56528Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012583Metagenome / Metatranscriptome279Y
F013094Metagenome / Metatranscriptome274Y
F023620Metagenome / Metatranscriptome209Y
F034959Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
GOS2239_10463362F013094GGAGGMISAFFTGVVVAIPTSLVMMKLLNSSLFINNSDLADMNQKISVIITQLDDYRE
GOS2239_10463363F012583N/ALMRLSDQVKIKTFDKYIMRGGDQSLQNIEDLCDFGFNMCQLGYDPEQFNDVVIDVICKLIEKLEDKS*
GOS2239_10463364F023620GGAGGMKTALFLTDYDLSTVHYLCSYYIDNANLDRQDVDYITELQNRVENLMEVK*
GOS2239_10463365F034959GGAGGMKIEINKEQLEILKYAVLWYECNDEEEERIVNELETKLYNAQEEDLLRSFTNMGGLN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.